PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_21610_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ZF-HD
Protein Properties Length: 240aa    MW: 26419.1 Da    PI: 7.9888
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_21610_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.14.4e-3344100259
                           ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                           +++rY+eClkNhA+ +GghavDGCgEfmp+ ge+gt +alkCaAC+CHRnFHR+e+e 
  cra_locus_21610_iso_1_len_1406_ver_3  44 TTYRYRECLKNHAVGIGGHAVDGCGEFMPA-GEDGTLDALKCAACNCHRNFHRKESEG 100
                                           5789*************************9.999********************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.0E-304698IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-244799IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-304797IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.8054897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.02E-21164238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-32166239IPR009057Homeodomain-like
TIGRFAMsTIGR015658.5E-25177233IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MEFDEHEEQE EEIGMTPQNQ MQGVSGGGGG GGGGTARKGG DRTTTYRYRE CLKNHAVGIG  60
GHAVDGCGEF MPAGEDGTLD ALKCAACNCH RNFHRKESEG EGFHQSHHHP HHSHHQFSSP  120
YAFRSAQPSG YLHVTHPPHH HLQQRPLALP STSRDDELDA SNPSSSGGGG GGSGGSKRRF  180
RTKFTQEQKD KMLAFAERVG WRIQKQDEAA VQQFCAETNV KRHVLKVWMH NNKHTLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-271762351675ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12434SGGGGGGGGGT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.16e-97PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ6YXH56e-81ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A068USE62e-95A0A068USE6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000336242e-91(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128